DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and Esx1

DIOPT Version :9

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_031983.2 Gene:Esx1 / 13984 MGIID:1096388 Length:382 Species:Mus musculus


Alignment Length:186 Identity:60/186 - (32%)
Similarity:72/186 - (38%) Gaps:72/186 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWRKQEKIGG 73
            |.||||..|..:||||||..|||..|||:|.|.|||.|:.|.|.||||||||||||||:      
Mouse   185 KPRRYRICFTPIQLQELEAFFQRVQYPDLFARVELARRLGLPEPRVQVWFQNRRAKWRR------ 243

  Fly    74 LGGDYKEGALDLDVSYDDSAVLGQLDSALGGGGTLLPDTPPQSSNSLDNELKASYGTGAMSPSRL 138
                                                              |:.:.....|.|..:
Mouse   244 --------------------------------------------------LRRAQAFRNMVPVAM 258

  Fly   139 SPNIFLNLNIDHLG----LERGGSGLSMEWSTYPPQTQAQTHPQMDSDNQLQQHPP 190
            ||.:.:.|: ||.|    :|       :.|..| |......||||   ..|...||
Mouse   259 SPPVGVYLD-DHYGPIPIVE-------VIWKCY-PMVPRPMHPQM---MPLPPRPP 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeobox 14..66 CDD:278475 34/51 (67%)
Esx1NP_031983.2 Homeobox 190..237 CDD:278475 29/46 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.