DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and Dlx5

DIOPT Version :10

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_034186.2 Gene:Dlx5 / 13395 MGIID:101926 Length:289 Species:Mus musculus


Alignment Length:206 Identity:52/206 - (25%)
Similarity:79/206 - (38%) Gaps:69/206 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RKQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWRKQEKIG 72
            :|.|:.||.:::.||..|:|.||:|.|..:..|.|||..:.||:.:|::||||:|:|.:|..|  
Mouse   135 KKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNKRSKIKKIMK-- 197

  Fly    73 GLGGDYKEGALDLDVSYDDSAVLGQLDSALGGGGTLLPDTPPQSSNSLDNELKASYGTGAMSPSR 137
                                            .|.:.|:..|.||:.:          ...||. 
Mouse   198 --------------------------------NGEMPPEHSPSSSDPM----------ACNSPQ- 219

  Fly   138 LSPNIFLNLNIDHLGLERGGSGLSMEWSTYP---PQTQAQTHPQMDSDNQLQQHPP-----QQHA 194
             ||.::          |..||..|:  |.:|   |.|..|:......:|....:|.     ..|.
Mouse   220 -SPAVW----------EPQGSSRSL--SHHPHAHPPTSNQSPASSYLENSASWYPSAASSINSHL 271

  Fly   195 SDPIHAGSSSH 205
            ..|   ||..|
Mouse   272 PPP---GSLQH 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeodomain 11..67 CDD:459649 24/55 (44%)
Dlx5NP_034186.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49
DLL_N 32..118 CDD:463567
Homeodomain 138..194 CDD:459649 24/55 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 198..253 18/78 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 270..289 5/13 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.