DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and Antp

DIOPT Version :10

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:XP_061506838.1 Gene:Antp / 1272720 VectorBaseID:AGAMI1_006863 Length:324 Species:Anopheles gambiae


Alignment Length:108 Identity:33/108 - (30%)
Similarity:47/108 - (43%) Gaps:28/108 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWRKQEKIGG 73
            :::|.|.|:...|..|||:.|....|.....|.|:|..:.|||.::::||||||.||:|:.|..|
Mosquito   243 ERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTKG 307

  Fly    74 LGGDYKEGALDLDVSYDDSAVLGQLDSALGGGGTLLPDTPPQS 116
            ..|...|..:                            |||||
Mosquito   308 EPGSGDENDM----------------------------TPPQS 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeodomain 11..67 CDD:459649 23/55 (42%)
AntpXP_061506838.1 None

Return to query results.
Submit another query.