DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and Cdx4

DIOPT Version :10

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_031700.1 Gene:Cdx4 / 12592 MGIID:88362 Length:282 Species:Mus musculus


Alignment Length:136 Identity:38/136 - (27%)
Similarity:57/136 - (41%) Gaps:44/136 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RKQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWRKQEKIG 72
            |.:.:||..:...|..|||:.|....|..:..:.||||.:.|:|.:|::||||||||.||..|  
Mouse   169 RTKEKYRVVYTDHQRLELEKEFHCNRYITIRRKSELAVNLGLSERQVKIWFQNRRAKERKMIK-- 231

  Fly    73 GLGGDYKEGALDLDVSYDDSAVLGQLDSALGGGGTLLPDTPPQSSNSLDNELKASYGTGAMSPSR 137
                                ..:.|.::.   ||::..|                  :|::||..
Mouse   232 --------------------KKISQFENT---GGSVQSD------------------SGSISPGE 255

  Fly   138 LSPNIF 143
            | ||.|
Mouse   256 L-PNAF 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeodomain 11..67 CDD:459649 23/55 (42%)
Cdx4NP_031700.1 Caudal_act 13..168 CDD:461413
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 13..36
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 98..156
Homeodomain 173..228 CDD:459649 23/54 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.