DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and Arx

DIOPT Version :9

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_001292869.1 Gene:Arx / 11878 MGIID:1097716 Length:564 Species:Mus musculus


Alignment Length:254 Identity:93/254 - (36%)
Similarity:120/254 - (47%) Gaps:49/254 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DKGTMKRKQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWR 66
            ::|.:|||||||||||.:.||:|||||||:|||||||.|||||:|:|||||||||||||||||||
Mouse   322 EEGLLKRKQRRYRTTFTSYQLEELERAFQKTHYPDVFTREELAMRLDLTEARVQVWFQNRRAKWR 386

  Fly    67 KQEKIG------GLGGDYKEGALDLDVSYDDSAVL----GQLDS----ALGGGGTLLPDTPPQSS 117
            |:||.|      ||.......|......|.|::..    ..|||    |........|..||.. 
Mouse   387 KREKAGAQTHPPGLPFPGPLSATHPLSPYLDASPFPPHHPALDSAWTAAAAAAAAAFPSLPPPP- 450

  Fly   118 NSLDNELKASYGTGAMSPS--RLSPNIFLNLNI-DHLGLERGGSGLSMEWSTYPPQTQAQTHPQM 179
                       |:.::.||  .|..:.||...: .|........|  ..:||..|.|.|.|...:
Mouse   451 -----------GSASLPPSGAPLGLSTFLGAAVFRHPAFISPAFG--RLFSTMAPLTSASTAAAL 502

  Fly   180 DSDNQLQQHPPQQHA-------SDPI------HAGSSSHHQQQQQQHQQEQHNPQLHPG 225
                 |:|..|....       :||.      .|.|.:..:.:.::|..:.....:.||
Mouse   503 -----LRQPTPAVEGAVASGALADPATAAADRRASSIAALRLKAKEHAAQLTQLNILPG 556

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeobox 14..66 CDD:278475 43/51 (84%)
ArxNP_001292869.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 54..79
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 111..264
Homeobox 334..386 CDD:278475 43/51 (84%)
OAR 528..545 CDD:281777 2/16 (13%)
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 532..545 1/12 (8%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BSUU
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454642at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm43910
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24329
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5874
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.