DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and Alx3

DIOPT Version :10

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_031467.1 Gene:Alx3 / 11694 MGIID:1277097 Length:343 Species:Mus musculus


Alignment Length:143 Identity:69/143 - (48%)
Similarity:88/143 - (61%) Gaps:26/143 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDKGTMKRKQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKW 65
            |:....|.|:||.||||:|.||:|||:.||:||||||:.||:||:|.||||||||||||||||||
Mouse   144 MELAKTKSKKRRNRTTFSTFQLEELEKVFQKTHYPDVYAREQLALRTDLTEARVQVWFQNRRAKW 208

  Fly    66 RKQEKIGGLGGDYKEGALDLDVSYDDSAVLGQLDSALGGGGTLLP--DTPPQSSNSLDNELKASY 128
            ||:|:.|.:    :||......:||.|               :||  |:.||    |.|.|..|.
Mouse   209 RKRERYGKM----QEGRNPFTTAYDIS---------------VLPRTDSHPQ----LQNSLWPSP 250

  Fly   129 GTGAM-SPSRLSP 140
            |:|:. .|..:||
Mouse   251 GSGSPGGPCLMSP 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeodomain 11..67 CDD:459649 43/55 (78%)
Alx3NP_031467.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..122
Homeodomain 154..210 CDD:459649 43/55 (78%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 309..343
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.