DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and Phox2a

DIOPT Version :9

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_446321.2 Gene:Phox2a / 116648 RGDID:621323 Length:281 Species:Rattus norvegicus


Alignment Length:211 Identity:78/211 - (36%)
Similarity:98/211 - (46%) Gaps:35/211 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KRKQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWRKQEKI 71
            ||||||.||||.:.||:||||.|..|||||::.|||||::||||||||||||||||||:||||:.
  Rat    87 KRKQRRIRTTFTSAQLKELERVFAETHYPDIYTREELALKIDLTEARVQVWFQNRRAKFRKQERA 151

  Fly    72 GGLGG-----DYKEGALDLDVSYDDSAVLGQLDSALGGGGTLLPDTPP----QSSNSLDNELKAS 127
            ....|     ..|:|........|||.  ....|........||..||    .|.....:.|.|:
  Rat   152 ASAKGAAGATGAKKGEARCSSEDDDSK--ESTCSPTPDSTASLPPPPPAPSLASPRLSPSPLPAA 214

  Fly   128 YGTGAMSPSRLSPNIFLNLNIDHLGLERGGSGLSMEWSTYPPQTQAQTHPQMDSDNQLQQHPPQQ 192
            .|:|. .|..|...::       .|:..||.|                .|...:...|:...|.:
  Rat   215 LGSGP-GPQPLKGALW-------AGVAGGGGG----------------GPGAGAAELLKAWQPAE 255

  Fly   193 HASDPIHAGSSSHHQQ 208
            ....|.....||.|::
  Rat   256 PGPGPFSGVLSSFHRK 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeobox 14..66 CDD:278475 39/51 (76%)
Phox2aNP_446321.2 Homeobox 94..147 CDD:395001 39/52 (75%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 145..219 19/75 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.