DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and Prrxl1

DIOPT Version :9

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:XP_006518472.1 Gene:Prrxl1 / 107751 MGIID:2148204 Length:354 Species:Mus musculus


Alignment Length:273 Identity:90/273 - (32%)
Similarity:114/273 - (41%) Gaps:93/273 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DKGTMKRKQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWR 66
            |.|.::|||||.||||...||:.||..|.:|||||||.|||||::|:||||||||||||||||||
Mouse   116 DDGFLRRKQRRNRTTFTLQQLEALEAVFAQTHYPDVFTREELAMKINLTEARVQVWFQNRRAKWR 180

  Fly    67 KQEKIGGLGGDYKEGALDLDVSYDDSAVLGQLDSALGGGGTLLPDTPPQSSN-----------SL 120
            |.|:                         |..|...|....:...|||...|           |.
Mouse   181 KTER-------------------------GASDQEPGAKEPMAEVTPPPVRNINSPPPGDQTRSK 220

  Fly   121 DNELKA--SYG-----TGAMSPSRLSPNIFLNL-----NIDHLGLERGG----------SGLSME 163
            ...|:|  |.|     ||...||.| |...||.     .:.|:...:||          .|||. 
Mouse   221 KEALEAQQSLGRTVGPTGPFFPSCL-PGTLLNTATYAQALSHVASLKGGPLCSCCVPDPMGLSF- 283

  Fly   164 WSTYPPQT-----------QAQTHPQ--MDSDNQL-----------QQHPPQQHASDPIHAGSSS 204
            ..||..|:           :|:.|.:  :.|.|.|           :|.||:         ||..
Mouse   284 LPTYGCQSNRTASVAALRMKAREHSEAVLQSANLLPSTSSSPGPASKQAPPE---------GSQD 339

  Fly   205 HHQQQQQQHQQEQ 217
            .....::|.:.|:
Mouse   340 KTSPTKEQSEGEK 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeobox 14..66 CDD:278475 38/51 (75%)
Prrxl1XP_006518472.1 Homeobox 128..181 CDD:365835 39/52 (75%)
OAR 292..309 CDD:367680 2/16 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454642at33208
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.