DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and CDX4

DIOPT Version :10

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_005184.1 Gene:CDX4 / 1046 HGNCID:1808 Length:284 Species:Homo sapiens


Alignment Length:115 Identity:34/115 - (29%)
Similarity:52/115 - (45%) Gaps:25/115 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RKQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWRKQEKIG 72
            |.:.:||..:...|..|||:.|....|..:..:.||||.:.|:|.:|::||||||||.||..|  
Human   171 RTKEKYRVVYTDHQRLELEKEFHCNRYITIQRKSELAVNLGLSERQVKIWFQNRRAKERKMIK-- 233

  Fly    73 GLGGDYKEGALDLDVSYDDSAVLGQLDSALGGGGTLLPDTPPQSSNSLDN 122
                                ..:.|.:::   ||::..|:...|...|.|
Human   234 --------------------KKISQFENS---GGSVQSDSDSISPGELPN 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeodomain 11..67 CDD:459649 23/55 (42%)
CDX4NP_005184.1 Caudal_act 13..170 CDD:461413
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 15..40
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 120..155
Homeodomain 175..230 CDD:459649 23/54 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 238..259 5/23 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.