DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and dbx1

DIOPT Version :10

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:XP_002940015.1 Gene:dbx1 / 100495433 XenbaseID:XB-GENE-480177 Length:328 Species:Xenopus tropicalis


Alignment Length:222 Identity:50/222 - (22%)
Similarity:88/222 - (39%) Gaps:71/222 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KGTMKRKQRRYRTTFNTLQLQELERAFQRTHY---PDVFFREELAVRIDLTEARVQVWFQNRRAK 64
            :|..:|...| |..|:.:|.:.||:.||:..|   ||   |::||.::.|.:::|::||||||.|
 Frog   166 RGKPRRGMLR-RAVFSDVQRKALEKMFQKQKYISKPD---RKKLAGKLGLKDSQVKIWFQNRRMK 226

  Fly    65 WRKQEKIGGLGGDYKEGALDLDVSYDDSAVLGQLDSALGGGGTLLPDTPPQSSNSLDNELKASYG 129
            ||                                                   ||.:.||.:|.|
 Frog   227 WR---------------------------------------------------NSKERELLSSGG 240

  Fly   130 TGAMS-PSRLSPNIFLNLNIDHLGLERGGSGLSMEWSTYPPQTQAQTHPQMDSDNQLQ---QHPP 190
            ....: |::.:|    :.::..:|.:..|.|........|    |.:.|....::.|:   |.||
 Frog   241 CREQTLPTKFNP----HPDLSDVGKKSSGEGEEEPMCNSP----AHSSPYQCPEHSLRLDAQLPP 297

  Fly   191 QQHASDPIHAGSSSHHQQQQQQHQQEQ 217
            ....|. |.:..|.....::::.:||:
 Frog   298 SPFNSS-IASKPSDFSDSEEEEGEQEE 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeodomain 11..67 CDD:459649 24/58 (41%)
dbx1XP_002940015.1 Homeodomain 175..229 CDD:459649 25/108 (23%)

Return to query results.
Submit another query.