DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and rax2

DIOPT Version :10

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:XP_002941436.1 Gene:rax2 / 100494721 XenbaseID:XB-GENE-494483 Length:227 Species:Xenopus tropicalis


Alignment Length:184 Identity:73/184 - (39%)
Similarity:90/184 - (48%) Gaps:45/184 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DKGTMKRKQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWR 66
            |....|:|.||.||||.|.||.||||||:|:|||||:.|||||:::.|.|.||||||||||||||
 Frog    28 DNELPKKKHRRNRTTFTTYQLHELERAFERSHYPDVYSREELAMKVSLPEVRVQVWFQNRRAKWR 92

  Fly    67 KQEKIGGLGGDYKEGALDLDVS---YDDSAVLGQLDSALGGG-GTLLPDTP--PQSSNSLDNELK 125
            :|||              |:.|   ..||.:|....|.:..| |.|....|  |..::.:.....
 Frog    93 RQEK--------------LETSSSKLHDSPLLSFSRSPMATGVGPLSNTLPLEPWLTSPIPGTTT 143

  Fly   126 ASYGTGAMSPSR-LSP----NIFLNLNIDHLGLERGGSGLSMEWSTYPPQTQAQ 174
            .......|:||: |.|    :.|||            ||        ||.|..|
 Frog   144 VHSMPAFMAPSQALQPTYQSHTFLN------------SG--------PPMTPIQ 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeodomain 11..67 CDD:459649 41/55 (75%)
rax2XP_002941436.1 Homeodomain 37..93 CDD:459649 41/55 (75%)
OAR 200..216 CDD:461067
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.