DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and drgx

DIOPT Version :9

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:XP_004915967.1 Gene:drgx / 100493837 XenbaseID:XB-GENE-993712 Length:263 Species:Xenopus tropicalis


Alignment Length:261 Identity:87/261 - (33%)
Similarity:114/261 - (43%) Gaps:74/261 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DKGTMKRKQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWR 66
            |.|.::|||||.||||...||:.||..|.:|||||||.|||||::|:||||||||||||||||||
 Frog    26 DDGFLRRKQRRNRTTFTLQQLEALEAVFAQTHYPDVFTREELAMKINLTEARVQVWFQNRRAKWR 90

  Fly    67 KQEKIGGLGGDYKEGALD-----------LDVSYDDSAVLGQL------------DSALGGGGTL 108
            |.|:    |...:|||.:           |..|.....|.|:.            |.|:|...:.
 Frog    91 KTER----GSCEQEGAKESAPEVTTAGRNLSPSSTVEPVRGKKETLEAQQRCLSHDRAVGSATSF 151

  Fly   109 LPDTPPQSSNSLDNELKASYGTGAMSPSRLSPNIFLNLNI-DHLGLERGGSGLSMEWSTYPP--- 169
            .|...|   .:|.|  .|||.......:.|..:...:..: |.|||           |..||   
 Frog   152 FPSCLP---GALLN--TASYAQALSHVASLKGSPLCSCCVSDPLGL-----------SFLPPYGC 200

  Fly   170 -----------QTQAQTHPQMDSDNQLQQ--------HPPQQHASDPIHAGSSSHHQQQQQQHQQ 215
                       :.:|:.|    |:..||.        :.....||.|:..|    |::..|..|.
 Frog   201 QSHRTASVAALRMKAREH----SEAVLQSAQLLPSAGNSTGASASAPLEGG----HERVPQAEQS 257

  Fly   216 E 216
            :
 Frog   258 D 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeobox 14..66 CDD:278475 38/51 (75%)
drgxXP_004915967.1 Homeobox 38..91 CDD:395001 39/52 (75%)
OAR 204..220 CDD:397759 2/19 (11%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454642at33208
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.