DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and arx

DIOPT Version :9

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:XP_002933659.1 Gene:arx / 100486727 XenbaseID:XB-GENE-483940 Length:536 Species:Xenopus tropicalis


Alignment Length:285 Identity:100/285 - (35%)
Similarity:128/285 - (44%) Gaps:82/285 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DKGTMKRKQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWR 66
            ::|.:|||||||||||.:.||:|||||||:|||||||.|||||:|:|||||||||||||||||||
 Frog   293 EEGMLKRKQRRYRTTFTSYQLEELERAFQKTHYPDVFTREELAMRLDLTEARVQVWFQNRRAKWR 357

  Fly    67 KQEKIGG------------LGGDYKEGALDLDVS-------YDDSAVLGQLDSALGGGGTLLPDT 112
            |:||.|.            |...:..|.. ||.|       ..|||    ..:|........|..
 Frog   358 KREKAGAQTHAPGLPFPGPLSASHPLGPY-LDASPFPPHHPALDSA----WTAAAAAAAAAFPSL 417

  Fly   113 PPQSSNSLDNELKASYGTGAMSPSRLSPNIFLNLNIDHLGLER--GGS----------GLSMEWS 165
            ||           ..:|:.|:.||. ||          |||..  |.:          .....:|
 Frog   418 PP-----------PPHGSAALPPSG-SP----------LGLSTFLGAAVFRHPAFISPAFGRLFS 460

  Fly   166 TYPPQTQAQT--------HPQMDSDNQLQQHPPQQHASDPIHAGSSSHHQQ-QQQQHQQEQHNPQ 221
            |..|.|.|.|        .|.::|..|      ....|||:.|.:...... ...:.:.::|..|
 Frog   461 TMAPLTSASTAAALLRQPSPAVESSVQ------SSGLSDPVTAAADRRASSIAALRLKAKEHAAQ 519

  Fly   222 LHPGLEFAASLSLDMTDGSSAYDEM 246
            |         ..|::..|:||..|:
 Frog   520 L---------TQLNIIPGNSAGKEV 535

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeobox 14..66 CDD:278475 43/51 (84%)
arxXP_002933659.1 Homeobox 305..358 CDD:365835 44/52 (85%)
OAR 500..518 CDD:367680 1/17 (6%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454642at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.