DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and arxb

DIOPT Version :10

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:XP_002667096.1 Gene:arxb / 100329907 ZFINID:ZDB-GENE-121109-2 Length:385 Species:Danio rerio


Alignment Length:71 Identity:57/71 - (80%)
Similarity:66/71 - (92%) Gaps:0/71 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DKGTMKRKQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWR 66
            :.|.:|||||||||||.:.||:|||||||:|||||||.|||||:|:|||||||||||||||||||
Zfish   154 EDGMLKRKQRRYRTTFTSYQLEELERAFQKTHYPDVFTREELAMRLDLTEARVQVWFQNRRAKWR 218

  Fly    67 KQEKIG 72
            |:||:|
Zfish   219 KREKVG 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeodomain 11..67 CDD:459649 47/55 (85%)
arxbXP_002667096.1 Homeodomain 163..219 CDD:459649 47/55 (85%)
OAR 351..369 CDD:461067
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.