DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and mxtx1

DIOPT Version :9

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_571635.2 Gene:mxtx1 / 100149566 ZFINID:ZDB-GENE-000710-7 Length:309 Species:Danio rerio


Alignment Length:223 Identity:57/223 - (25%)
Similarity:90/223 - (40%) Gaps:42/223 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GTMKRK-QRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWRK 67
            |.:.|. .||.||:|:...::.|...|:...||.:..||.|:....|.|:|:|||||||||:..|
Zfish    17 GAVSRSASRRKRTSFSKEHVELLRATFETDPYPGISLRESLSQTTGLPESRIQVWFQNRRARTLK 81

  Fly    68 QEKIGGLGGDYKEGALDL----DVSYDDSAVLGQLDSALGGGGTLLPDTPPQSSNSLDNELKASY 128
            .:     ||.......||    ::......:..:.:.:.|..|||. ..||...:.:..|::...
Zfish    82 CK-----GGKKPLWQTDLPAYNNMQTSPMQIHRKNNESSGATGTLC-SPPPAYPDRIKEEMEKDA 140

  Fly   129 GTGAMSPSRLS---------PNIFLN------------LNIDH-----LGLERG-GSGLSMEWST 166
            ..|..:||.:|         |:...:            |:.:|     .|:..| .|.:|..||.
Zfish   141 VCGCDTPSSMSISDDSGYCTPSYHQSRAIQSHMSPSPLLSPEHQMPPNWGVRYGRRSPMSSMWSP 205

  Fly   167 YPPQTQAQT----HPQMDSDNQLQQHPP 190
            |..:..|..    :...:..|.||...|
Zfish   206 YHLEAYACNPGFFYSHSEKHNTLQPLTP 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeobox 14..66 CDD:278475 22/51 (43%)
mxtx1NP_571635.2 HOX 24..78 CDD:197696 23/53 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
32.870

Return to query results.
Submit another query.