DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cold and LOC691277

DIOPT Version :9

Sequence 1:NP_001259838.1 Gene:cold / 33237 FlyBaseID:FBgn0031268 Length:153 Species:Drosophila melanogaster
Sequence 2:XP_008765934.1 Gene:LOC691277 / 691277 RGDID:1586234 Length:275 Species:Rattus norvegicus


Alignment Length:150 Identity:29/150 - (19%)
Similarity:47/150 - (31%) Gaps:41/150 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LCSQVNF--------VAGLECYVCSNQTGNTEKCLNTIKTCEPFENVC----GTEIRWGSQPYFS 68
            :|:|::.        ..|::|.....:.|...  :.|:..|...|..|    ||.:.       |
  Rat   145 MCNQLDTQPSQVPAKANGVQCLAWYMEAGMPR--IPTLLKCTGSETKCVSFMGTAVG-------S 200

  Fly    69 EGALKQYYVSKRCMTKEQCQSKRKRYMQLYCTHIWYEDWACNECCKGDRCNYFVISGAPSRQGYG 133
            ...|....:...|.|:..|        .|..|  .::.......|.|....:...|.:|:|.|..
  Rat   201 SSLLSLVVIGMGCATESAC--------NLNMT--VFDSVNIRTFCSGGLPVFSTTSSSPNRTGLR 255

  Fly   134 ----------VCLTLLTALL 143
                      :.|.||..||
  Rat   256 PAFISTVPVLISLLLLKVLL 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
coldNP_001259838.1 LU 26..119 CDD:299177 17/96 (18%)
LOC691277XP_008765934.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20914
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.