DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cold and LYPD8

DIOPT Version :9

Sequence 1:NP_001259838.1 Gene:cold / 33237 FlyBaseID:FBgn0031268 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_001078943.2 Gene:LYPD8 / 646627 HGNCID:44208 Length:237 Species:Homo sapiens


Alignment Length:117 Identity:27/117 - (23%)
Similarity:46/117 - (39%) Gaps:22/117 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IAVVLVAAVYLCSQVNFVAGLECYVCSNQTGNTEKCLNTIKT-CEPFENVCGTEIRWGSQPYFSE 69
            |..|||||         |..|.|..|::.   .:.|:|:|.: |....|   |.....|.....|
Human     9 ITAVLVAA---------VESLSCVQCNSW---EKSCVNSIASECPSHAN---TSCISSSASSSLE 58

  Fly    70 GALKQYYVSKRCMTKEQCQSKRKRYMQLYCTHIWYED--WACNECCKGDRCN 119
            ..::.|  .....:.|.|  ..:.::..:..|:..|:  ...::||:|..|:
Human    59 TPVRLY--QNMFCSAENC--SEETHITAFTVHVSAEEHFHFVSQCCQGKECS 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
coldNP_001259838.1 LU 26..119 CDD:299177 19/95 (20%)
LYPD8NP_001078943.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20914
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.