DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cold and AC3.12

DIOPT Version :9

Sequence 1:NP_001259838.1 Gene:cold / 33237 FlyBaseID:FBgn0031268 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_001256213.1 Gene:AC3.12 / 13214753 WormBaseID:WBGene00077503 Length:94 Species:Caenorhabditis elegans


Alignment Length:95 Identity:23/95 - (24%)
Similarity:34/95 - (35%) Gaps:20/95 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 VCSNQTGNTEKCLNTIK-TCEPFENVCGTEIRWGSQPYFSEGALKQYYVSKRCMTKEQCQSKR-- 91
            :||......|:..|.:| |||.....|......|::.:.:..|              .|||..  
 Worm     7 LCSRGLVKGEQMENYVKETCETGMKYCFESYSKGTEDFDTATA--------------SCQSLNTD 57

  Fly    92 KRYMQLYC--THIWYEDWACNECCKGDRCN 119
            :|.:.| |  ..|..:......||:.|.||
 Worm    58 RRLLNL-CEGEKIEVKAGVTVRCCESDLCN 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
coldNP_001259838.1 LU 26..119 CDD:299177 21/93 (23%)
AC3.12NP_001256213.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1493078at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.