DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cold and LOC101731278

DIOPT Version :9

Sequence 1:NP_001259838.1 Gene:cold / 33237 FlyBaseID:FBgn0031268 Length:153 Species:Drosophila melanogaster
Sequence 2:XP_004919284.1 Gene:LOC101731278 / 101731278 -ID:- Length:118 Species:Xenopus tropicalis


Alignment Length:153 Identity:37/153 - (24%)
Similarity:55/153 - (35%) Gaps:37/153 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKSWEIAVVLVAAVYLCSQVNFVAGLECYVCSNQTGNTEKCLNTIKTCEPFENVCGTEIRWGSQP 65
            |.:..||:::.|   ||:  .....|:||.|::|:.|. .| .|..:|..:|..|.|.:      
 Frog     1 MATLSIALIVTA---LCA--GSALSLKCYTCTSQSTNA-NC-KTEGSCNIYEVFCRTNV------ 52

  Fly    66 YFSEGALKQYYVSKRCMTKEQCQSKRKRYMQLYCTHIWYEDWACNECCKGDRCNYFVISGAPSRQ 130
               ..:.....::|.|.|.....|.....:               .||..|.||   :|||   .
 Frog    53 ---VSSTTGISITKSCATSCAPSSVETNTV---------------ACCSTDLCN---LSGA---T 93

  Fly   131 GYGVCLTLLTALLGLGSWLIPRS 153
            |......||...||....|:..|
 Frog    94 GVSYSSALLALSLGFALVLVKNS 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
coldNP_001259838.1 LU 26..119 CDD:299177 19/92 (21%)
LOC101731278XP_004919284.1 LU 21..88 CDD:299177 19/92 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1493078at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.