DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cold and LOC101730741

DIOPT Version :9

Sequence 1:NP_001259838.1 Gene:cold / 33237 FlyBaseID:FBgn0031268 Length:153 Species:Drosophila melanogaster
Sequence 2:XP_004919490.1 Gene:LOC101730741 / 101730741 -ID:- Length:126 Species:Xenopus tropicalis


Alignment Length:146 Identity:40/146 - (27%)
Similarity:55/146 - (37%) Gaps:34/146 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EIAVVLVAAVYLCSQVNFVAGLECYVCSNQTGNTEKCLNTIKTCEPFENVCGTEIRWGSQPYFSE 69
            ::.||||... ||  :.....|.||.||.|:.|| .|: |...|...:..|.|.:..|     ..
 Frog     3 DLRVVLVLTA-LC--IGTAVSLTCYTCSGQSTNT-NCM-TATNCTASQTYCKTSVIAG-----GI 57

  Fly    70 GALKQYYVSKRCMTKEQCQSKRKRYMQLYCTHIWYEDWACN---ECCKGDRCNYFVISGA----P 127
            |:|....::|.|              :..||.:.......:   .||..|.||   .|||    |
 Frog    58 GSLSAATITKSC--------------ESICTSVSLSAIVVSTSVSCCSTDLCN---TSGAAGIKP 105

  Fly   128 SRQGYGVCLTLLTALL 143
            |..|..:.|..:..||
 Frog   106 SSIGLALSLGFVLLLL 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
coldNP_001259838.1 LU 26..119 CDD:299177 23/95 (24%)
LOC101730741XP_004919490.1 LU 21..96 CDD:238065 23/95 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1493078at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.