DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ipk2 and KCS1

DIOPT Version :9

Sequence 1:NP_608535.1 Gene:Ipk2 / 33236 FlyBaseID:FBgn0031267 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_010300.3 Gene:KCS1 / 851580 SGDID:S000002424 Length:1050 Species:Saccharomyces cerevisiae


Alignment Length:256 Identity:61/256 - (23%)
Similarity:111/256 - (43%) Gaps:48/256 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 SGDNDLLALLRGHVPRFYGPLKLVVNRRERT-------FLRLEDLTRSYAKPCVMDVKMGKRTWD 126
            ||.|.::..|..:|...|....:.....|.|       |:.||||||:..|||.:|:|||.|.:.
Yeast   721 SGKNMIIKSLAYNVSNDYSHHDIESITFEETSHTIVSKFILLEDLTRNMNKPCALDLKMGTRQYG 785

  Fly   127 PESSPNKRKVEEAKYV-MCKQKLGLCLPGFQVYLPKEEHTQETTILRHGKDYGKSLNVE-GFKQT 189
            .::...|:..:.||.: ...::||:.:.|.:|:       .:...:...|.:|:.:.|. .|.:.
Yeast   786 VDAKRAKQLSQRAKCLKTTSRRLGVRICGLKVW-------NKDYYITRDKYFGRRVKVGWQFARV 843

  Fly   190 MALF-FNASTSDSKSRRAGCELLLKEVLRQLQEILAWFQRQRLLHFYASSLLICYDYSRLADPPK 253
            :|.| ::..|.:|..|:      :..:::||..:.:.....:....|.:|||:.||    .|..|
Yeast   844 LARFLYDGKTIESLIRQ------IPRLIKQLDTLYSEIFNLKGYRLYGASLLLMYD----GDANK 898

  Fly   254 PLINGYHQNDDDPATWVRVKMIDFA---------------HVYPAEQGLPDENYMFGLQSL 299
                  ..:....|..|:|.:||||               .:.|....:.|:.::.|::||
Yeast   899 ------SNSKRKKAANVKVNLIDFARCVTKEDAMECMDKFRIPPKSPNIEDKGFLRGVKSL 953

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ipk2NP_608535.1 IPK 100..304 CDD:281727 53/218 (24%)
KCS1NP_010300.3 IPK 759..957 CDD:397715 53/218 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I2739
eggNOG 1 0.900 - - E1_KOG1620
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3597
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.