DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ipk2 and IPK2BETA

DIOPT Version :9

Sequence 1:NP_608535.1 Gene:Ipk2 / 33236 FlyBaseID:FBgn0031267 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_001331991.1 Gene:IPK2BETA / 836298 AraportID:AT5G61760 Length:300 Species:Arabidopsis thaliana


Alignment Length:317 Identity:93/317 - (29%)
Similarity:139/317 - (43%) Gaps:69/317 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 QVAGHTFEESNAEAVGLLQDSKAGCVLKPLGKPECGERELRFYESLAEAGASGDNDLLALLRGHV 82
            |||||...:..   :|.|.|.: |...|||.....||.|.:||||........|         |:
plant     8 QVAGHIASDGK---LGPLVDDQ-GRFFKPLQGDSRGEHEAKFYESFTSNMKVPD---------HI 59

  Fly    83 PRFY-------------GPLKLVVNRRERTFLRLEDLTRSYAKPCVMDVKMGKRTWDPESSPNKR 134
            .|::             |..||       ..|.|:|:...||.|.|||||:|.|||.|:      
plant    60 HRYFPVYHGTQLVEASDGSGKL-------PHLVLDDVVSGYANPSVMDVKIGSRTWYPD------ 111

  Fly   135 KVEEAKYVMCKQK--------LGLCLPGFQVYLPKEEHTQETTILRHGKDYGKSLNVEGFKQTMA 191
             |.|..:..|.:|        ||..:.||:::    :| ||::..|..|......|.:|.:..:.
plant   112 -VSEEYFKKCIKKDRQTTTVSLGFRVSGFKIF----DH-QESSFWRAEKKLVLGYNADGARLALR 170

  Fly   192 LFFNASTSDSKSRRAGCELL------LKEVLRQLQEILAWFQRQRLLHFYASSLLICYDYSRLAD 250
            .|.::::....:....|...      ...:|.||.|:..||:.|.|.||.:.|:|:.|:...:  
plant   171 KFVSSNSPADSNLTPNCAFASEVYGGCNGILAQLLELKDWFETQTLYHFNSCSILMIYENESI-- 233

  Fly   251 PPKPLINGYHQNDDDPATWVRVKMIDFAHVYPAEQGLPDENYMFGLQSLIEVVQSIL 307
                |:.|   .||.||...:||::|||||... .|:.|.|::.||.|.|:.::.||
plant   234 ----LMQG---GDDAPAPRAQVKLVDFAHVLDG-NGVIDHNFLGGLCSFIKFIKDIL 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ipk2NP_608535.1 IPK 100..304 CDD:281727 66/217 (30%)
IPK2BETANP_001331991.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 89 1.000 Domainoid score I2695
eggNOG 1 0.900 - - E1_KOG1620
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H76214
Inparanoid 1 1.050 107 1.000 Inparanoid score I2104
OMA 1 1.010 - - QHG54492
OrthoDB 1 1.010 - - D902814at2759
OrthoFinder 1 1.000 - - FOG0003587
OrthoInspector 1 1.000 - - otm3571
orthoMCL 1 0.900 - - OOG6_104761
Panther 1 1.100 - - LDO PTHR12400
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2060
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.