DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ipk2 and Ip6k3

DIOPT Version :9

Sequence 1:NP_608535.1 Gene:Ipk2 / 33236 FlyBaseID:FBgn0031267 Length:309 Species:Drosophila melanogaster
Sequence 2:XP_008771000.1 Gene:Ip6k3 / 688862 RGDID:1584104 Length:401 Species:Rattus norvegicus


Alignment Length:310 Identity:97/310 - (31%)
Similarity:142/310 - (45%) Gaps:65/310 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 HTFEESNAEAVGLLQDSKAGCVLKPLGKPECGERELRFYESLAEAGASGDNDL-LALLRGHVPRF 85
            |:.:||.|:|: |..|........||.:...|.:..|          .|.|.. |...:.|:.|.
  Rat   128 HSLKESAAKAL-LRSDCHLSTQASPLVESAVGSQIER----------KGFNPWGLHCHQAHLSRL 181

  Fly    86 YGPLKLVVNRRERTFLRLEDLTRSYAKPCVMDVKMGKRTWDPESSPNKRKVEEAKYVMCKQKLGL 150
            ..  :...::|.| ||.||::...|.:||::|:|||.|....::|..|:.....|   |.|....
  Rat   182 CS--QYPEDKRHR-FLLLENVVSQYKQPCILDLKMGTRQHGDDASEEKKARHMKK---CAQSTSA 240

  Fly   151 CLP----GFQVYLPKEEHTQETTILRHGKDYGKSLNVEGFKQTMALFFNASTSDSKSRRAGCEL- 210
            ||.    |.|||     .|.:.:.|...|.||:.|:||||:|.::.|.:          .|..| 
  Rat   241 CLGVRICGMQVY-----QTDKKSFLCKDKYYGRKLSVEGFRQALSQFLH----------DGIRLR 290

  Fly   211 --LLKEVLRQLQEILAWFQRQRLLHFYASSLLICYDYSRLADPPKPL---------INGYHQNDD 264
              ||:.:||:||.:|...:.|....||:|||||.||    .:||:..         .:|  ....
  Rat   291 TELLEPILRRLQALLTVIRSQSSYRFYSSSLLIIYD----GEPPQTAPAPQTTQGSTSG--STSG 349

  Fly   265 DPATWVRVKMIDFAH-VYPAE-------QGLPDENYMFGLQSLIEVVQSI 306
            |||. |.|:|||||| .|...       :| ||..|:|||::||.:::.|
  Rat   350 DPAK-VDVRMIDFAHTTYKGSWNERTTYEG-PDPGYIFGLENLIGILRDI 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ipk2NP_608535.1 IPK 100..304 CDD:281727 78/227 (34%)
Ip6k3XP_008771000.1 IPK 193..395 CDD:281727 78/227 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1620
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D452635at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.