DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ipk2 and IP6K2

DIOPT Version :9

Sequence 1:NP_608535.1 Gene:Ipk2 / 33236 FlyBaseID:FBgn0031267 Length:309 Species:Drosophila melanogaster
Sequence 2:XP_006713262.1 Gene:IP6K2 / 51447 HGNCID:17313 Length:485 Species:Homo sapiens


Alignment Length:243 Identity:77/243 - (31%)
Similarity:122/243 - (50%) Gaps:49/243 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 NRRERTFLRLEDLTRSYAKPCVMDVKMGKRTWDPESSPNKRKVEEAKYVMCKQK----LGLCLPG 154
            :|.:..|:.||:||..|..|||:|:|||.|....::|..|...:..|   |:|.    :|:.:.|
Human   256 HRNQYKFILLENLTSRYEVPCVLDLKMGTRQHGDDASEEKAANQIRK---CQQSTSAVIGVRVCG 317

  Fly   155 FQVYLPKEEHTQETTILRHGKDYGKSLNVEGFKQTMALFFNASTSDSKSRRAGCELLLKEVLRQL 219
            .|||     ......::...|.:|:.|:|:|||:.:..||:   :....||.    ||..||::|
Human   318 MQVY-----QAGSGQLMFMNKYHGRKLSVQGFKEALFQFFH---NGRYLRRE----LLGPVLKKL 370

  Fly   220 QEILAWFQRQRLLHFYASSLLICYDYSRLADPPKPLINGYHQNDDD------------------P 266
            .|:.|..:||....||:||||:.||..   :.|:.:::...::.:|                  .
Human   371 TELKAVLERQESYRFYSSSLLVIYDGK---ERPEVVLDSDAEDLEDLSEESADESAGAYAYKPIG 432

  Fly   267 ATWVRVKMIDFAH----VYPAE----QGLPDENYMFGLQSLIEVVQSI 306
            |:.|.|:||||||    :|..:    :| .|..|:|||||||::|..|
Human   433 ASSVDVRMIDFAHTTCRLYGEDTVVHEG-QDAGYIFGLQSLIDIVTEI 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ipk2NP_608535.1 IPK 100..304 CDD:281727 74/233 (32%)
IP6K2XP_006713262.1 IPK 262..477 CDD:281727 74/233 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1620
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D452635at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3597
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.