DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ipk2 and Ip6k1

DIOPT Version :9

Sequence 1:NP_608535.1 Gene:Ipk2 / 33236 FlyBaseID:FBgn0031267 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_038813.2 Gene:Ip6k1 / 27399 MGIID:1351633 Length:433 Species:Mus musculus


Alignment Length:247 Identity:72/247 - (29%)
Similarity:109/247 - (44%) Gaps:53/247 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 NRRERTFLRLEDLTRSYAKPCVMDVKMGKRTWDPESSPNKRKVEEAKYVMCKQK----LGLCLPG 154
            :|:...||.||::...:..|||:|:|||.|....::|..|...:..|   |:|.    ||:.:.|
Mouse   201 DRKLYKFLLLENVVHHFKYPCVLDLKMGTRQHGDDASAEKAARQMRK---CEQSTSATLGVRVCG 262

  Fly   155 FQVYLPKEEHTQETTILRHGKDYGKSLNVEGFKQTMALFFNASTSDSKSRRAGCEL---LLKEVL 216
            .|||.....|     .|...|.||:.|::|||:..:..:.:          .|.:|   |.:.:|
Mouse   263 MQVYQLDTGH-----YLCRNKYYGRGLSIEGFRNALYQYLH----------NGLDLRRDLFEPIL 312

  Fly   217 RQLQEILAWFQRQRLLHFYASSLLICYDYS------RL---------ADPP-----KPLINGYHQ 261
            .:|:.:.|..:||....||:||||:.||..      ||         ..||     .|.......
Mouse   313 SKLRGLKAVLERQASYRFYSSSLLVIYDGKECRSELRLKHVDMGLPEVPPPCGPSTSPSSTSLEA 377

  Fly   262 NDDDPATWVRVKMIDFAHVY-------PAEQGLPDENYMFGLQSLIEVVQSI 306
            ....|.. |.|:||||||..       |.....||..|:|||::||.:::.:
Mouse   378 GPSSPPK-VDVRMIDFAHSTFKGFRDDPTVHDGPDRGYVFGLENLISIMEQM 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ipk2NP_608535.1 IPK 100..304 CDD:281727 71/237 (30%)
Ip6k1NP_038813.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 100..160
IPK 207..426 CDD:281727 71/237 (30%)
Substrate binding. /evidence=ECO:0000250 220..228 5/7 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 359..383 3/23 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1620
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3597
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.