DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ipk2 and Ip6k3

DIOPT Version :9

Sequence 1:NP_608535.1 Gene:Ipk2 / 33236 FlyBaseID:FBgn0031267 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_766615.1 Gene:Ip6k3 / 271424 MGIID:3045325 Length:396 Species:Mus musculus


Alignment Length:311 Identity:98/311 - (31%)
Similarity:147/311 - (47%) Gaps:63/311 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 TQVAGHTFEESNAEAVGLLQDSKAGCVLKPLGKPECGERELRFYESLAEAGASGDNDL-LALLRG 80
            ||:| .:.:||.|:.: |..|........||.:.|.|.:..|          .|.|.. |...:.
Mouse   124 TQLA-RSLKESAAKVL-LRSDCHLSTQASPLVESEDGSQVER----------KGFNPWGLHCHQA 176

  Fly    81 HVPRFYGPLKLVVNRRERTFLRLEDLTRSYAKPCVMDVKMGKRTWDPESSPNKRKVEEAKYVMCK 145
            |:.|...  :...::|.| ||.||::...|.:||::|:|||.|....::|..|:.....|   |.
Mouse   177 HLTRLCS--QYPEDKRHR-FLLLENVVSQYKQPCILDLKMGTRQHGDDASEEKKARHMKK---CA 235

  Fly   146 QKLGLCLP----GFQVYLPKEEHTQETTILRHGKDYGKSLNVEGFKQTMALFFNASTSDSKSRRA 206
            |....||.    |.|||     .|.:.:.|...|.||:.|:||||:|.::.|.:..|      |.
Mouse   236 QSTSACLGVRICGMQVY-----QTDQKSFLCKDKYYGRKLSVEGFRQALSQFLHDGT------RL 289

  Fly   207 GCELLLKEVLRQLQEILAWFQRQRLLHFYASSLLICYDYSRLADPPKP--------LINGYHQND 263
            ..| ||:.:||:||.:|...:.|....||:||:||.||    .:||:.        :.:|     
Mouse   290 RAE-LLEPILRRLQALLTVIRSQSSYRFYSSSVLIIYD----GEPPQTTQGSTSGGVTSG----- 344

  Fly   264 DDPATWVRVKMIDFAHV--------YPAEQGLPDENYMFGLQSLIEVVQSI 306
             |||. |.|:||||||.        :...:| ||..|:|||::||.:::.|
Mouse   345 -DPAK-VDVRMIDFAHTTFKGSWNEHTTYEG-PDPGYIFGLENLIGILRDI 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ipk2NP_608535.1 IPK 100..304 CDD:281727 77/223 (35%)
Ip6k3NP_766615.1 IPK 193..390 CDD:281727 77/223 (35%)
Substrate binding. /evidence=ECO:0000250 206..214 4/7 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1620
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D452635at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3597
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.