DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ipk2 and F30A10.3

DIOPT Version :9

Sequence 1:NP_608535.1 Gene:Ipk2 / 33236 FlyBaseID:FBgn0031267 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_492519.2 Gene:F30A10.3 / 172779 WormBaseID:WBGene00009262 Length:332 Species:Caenorhabditis elegans


Alignment Length:224 Identity:61/224 - (27%)
Similarity:108/224 - (48%) Gaps:50/224 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 FLRLEDLTRSYAKPCVMDVKMGKRTWDPESSPNKRKVEEAKYVMCKQK----LGLCLPGFQVYLP 160
            ||.||::...|.:|||:|:|:|.|....::|.:||   ..:.:.|:..    ||:.:.|.|:|  
 Worm   132 FLLLENVVAHYTRPCVLDLKIGTRQHGDDASESKR---HRQLMKCRHSTSATLGVRVVGMQLY-- 191

  Fly   161 KEEHTQETTILRHGKDYGKSLNVEGFKQTMALFFNASTSDSKSRRAGCELLLKEVLRQLQEILAW 225
             |..|:..:.:.  |..|:.::..||:..:..|....   .:||.|    .:::.|.:|:.:||.
 Worm   192 -EAETKSYSYVE--KQEGRRIDAAGFRGYVKRFIKCC---GRSRAA----RIRQKLSKLRSLLAE 246

  Fly   226 FQRQRLLHFYASSLLICYDYSRLADPPKPLINGYHQNDDDPATWVRVKMIDFAH----------V 280
            |:..|   |:::|:||.:| :..||          .:.||.   |:|.:|||||          .
 Worm   247 FEGYR---FFSASILIAFD-AEAAD----------SSSDDA---VKVCIIDFAHSTFSGFFEDLA 294

  Fly   281 YPAEQGLPDENYMFGLQSLIEVVQSILHR 309
            |..    .||..:.||.|::|.::.|:.:
 Worm   295 YSG----ADEGCLLGLDSIVEAMEPIVSK 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ipk2NP_608535.1 IPK 100..304 CDD:281727 60/217 (28%)
F30A10.3NP_492519.2 IPK 132..314 CDD:281727 60/217 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1620
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D452635at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3597
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.