| Sequence 1: | NP_477294.2 | Gene: | Nle / 33234 | FlyBaseID: | FBgn0021874 | Length: | 488 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001011411.1 | Gene: | wdr5 / 496891 | XenbaseID: | XB-GENE-493883 | Length: | 334 | Species: | Xenopus tropicalis |
| Alignment Length: | 117 | Identity: | 27/117 - (23%) |
|---|---|---|---|
| Similarity: | 42/117 - (35%) | Gaps: | 22/117 - (18%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 86 IVEEDFTPEQIEHIKRGLRQIESVTCLKFVTRTEEPDYVRVIGTGSGC-YSSVGHRGGAQTLNLE 149
Fly 150 PYDVDT--GCFRLATIVHEFIHAVGFYHQQSASD--RDQFVQI----VWDNI 193 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Nle | NP_477294.2 | NLE | 22..82 | CDD:462380 | |
| WD40 | 84..486 | CDD:441893 | 27/117 (23%) | ||
| WD40 repeat | 123..159 | CDD:293791 | 10/38 (26%) | ||
| WD40 repeat | 164..202 | CDD:293791 | 9/36 (25%) | ||
| WD40 repeat | 208..249 | CDD:293791 | |||
| WD40 repeat | 254..289 | CDD:293791 | |||
| WD40 repeat | 296..372 | CDD:293791 | |||
| WD40 repeat | 378..414 | CDD:293791 | |||
| WD40 repeat | 420..456 | CDD:293791 | |||
| WD40 repeat | 462..486 | CDD:293791 | |||
| wdr5 | NP_001011411.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..32 | ||
| WD40 | <36..330 | CDD:441893 | 27/117 (23%) | ||
| WD 1 | 43..82 | ||||
| WD40 repeat | 48..85 | CDD:293791 | |||
| WD 2 | 85..126 | 2/11 (18%) | |||
| WD40 repeat | 91..127 | CDD:293791 | 2/12 (17%) | ||
| WD 3 | 128..168 | 13/50 (26%) | |||
| WD40 repeat | 132..168 | CDD:293791 | 13/46 (28%) | ||
| WD 4 | 169..208 | 7/40 (18%) | |||
| WD40 repeat | 175..210 | CDD:293791 | 8/36 (22%) | ||
| WD 5 | 212..253 | 3/6 (50%) | |||
| WD40 repeat | 217..253 | CDD:293791 | 0/1 (0%) | ||
| WD 6 | 256..296 | ||||
| WD40 repeat | 261..298 | CDD:293791 | |||
| WD 7 | 299..333 | ||||
| WD40 repeat | 304..330 | CDD:293791 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||