DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2794 and AT1G50510

DIOPT Version :9

Sequence 1:NP_608533.1 Gene:CG2794 / 33233 FlyBaseID:FBgn0031265 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_564574.2 Gene:AT1G50510 / 841473 AraportID:AT1G50510 Length:330 Species:Arabidopsis thaliana


Alignment Length:309 Identity:153/309 - (49%)
Similarity:210/309 - (67%) Gaps:9/309 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 RSLHRKHDHIVLHPEIRQALQLQKPVVALESTIITHGMPMPENVVTALAVEEQVRQNGAIPATIG 83
            |||      :.:.|::.:||...:.|||||||||:||||.|:|:.||..||..||:||||||||.
plant    27 RSL------VKISPQVSEALSNGRAVVALESTIISHGMPYPQNLQTAKEVESIVRENGAIPATIA 85

  Fly    84 ILDGRIKVGLTREELTSLAEKPRDQVIKCSRRDLPFVVSRRQSGGTTVAATMIIAHRVGIHVFAT 148
            ||:|...:||:.|||..||...: .|.|.:.||:..||:.|.:|.|||:||:..|..|||.||.|
plant    86 ILNGVPCIGLSEEELERLASLGK-SVQKTAGRDIANVVATRGNGATTVSATLFFASMVGIQVFVT 149

  Fly   149 GGIGGVHRDGHESMDVSADLTELGRTPVAVVCSGVKSILDIPRTLEFLETQGVCVASFDSPGGVF 213
            ||||||||..:.|||:|:|||.|||||:||:.:|||||||||:|||:||||.|.||::.|  ..|
plant   150 GGIGGVHRHANHSMDISSDLTALGRTPIAVISAGVKSILDIPKTLEYLETQEVYVAAYKS--DEF 212

  Fly   214 PDFYTRDSGCTVPYNLKSAQEAAELLRSWRELKMESGLVIGVPIPEEFAADKFKIEEAIKEATAQ 278
            |.|:|..|||..|..:.|.::.|.::.:..:|..::|::..:|||:..:|....||.|.:.|..:
plant   213 PAFFTEKSGCKAPSRVNSPEDCARVIDANMKLNRQAGILFAIPIPKHHSAAGNLIESATQRALTE 277

  Fly   279 ARAQGISGKEVTPFLLAAIAKITEGRSLKSNIALIKNNAKVAAQIAASL 327
            ||.|.::|...||||||.:.::|.|.||.:||||:||||.:.:|||.:|
plant   278 AREQNVTGNAETPFLLARVNELTGGTSLAANIALVKNNALIGSQIAVAL 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2794NP_608533.1 Indigoidine_A 34..324 CDD:282130 146/289 (51%)
YeiC_kinase_like 345..669 CDD:238916
AT1G50510NP_564574.2 Indigoidine_A 36..325 CDD:398073 148/291 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 274 1.000 Domainoid score I421
eggNOG 1 0.900 - - E1_COG2313
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H43606
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006303
OrthoInspector 1 1.000 - - oto3832
orthoMCL 1 0.900 - - OOG6_103921
Panther 1 1.100 - - LDO PTHR42909
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5255
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.770

Return to query results.
Submit another query.