DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2794 and CG7328

DIOPT Version :9

Sequence 1:NP_608533.1 Gene:CG2794 / 33233 FlyBaseID:FBgn0031265 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_649181.1 Gene:CG7328 / 40204 FlyBaseID:FBgn0036942 Length:306 Species:Drosophila melanogaster


Alignment Length:30 Identity:17/30 - (56%)
Similarity:21/30 - (70%) Gaps:1/30 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   628 IVNVSGAGDSFCAGFITALLRG-RSLDECI 656
            :|:..||||||.||||.|.|:. |||.|.:
  Fly   251 VVDTLGAGDSFMAGFIYATLKARRSLAEAV 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2794NP_608533.1 Indigoidine_A 34..324 CDD:282130
YeiC_kinase_like 345..669 CDD:238916 17/30 (57%)
CG7328NP_649181.1 Ketohexokinase 6..297 CDD:238914 17/30 (57%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456445
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.