powered by:
Protein Alignment CG2794 and CG7328
DIOPT Version :9
Sequence 1: | NP_608533.1 |
Gene: | CG2794 / 33233 |
FlyBaseID: | FBgn0031265 |
Length: | 700 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_649181.1 |
Gene: | CG7328 / 40204 |
FlyBaseID: | FBgn0036942 |
Length: | 306 |
Species: | Drosophila melanogaster |
Alignment Length: | 30 |
Identity: | 17/30 - (56%) |
Similarity: | 21/30 - (70%) |
Gaps: | 1/30 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 628 IVNVSGAGDSFCAGFITALLRG-RSLDECI 656
:|:..||||||.||||.|.|:. |||.|.:
Fly 251 VVDTLGAGDSFMAGFIYATLKARRSLAEAV 280
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45456445 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.840 |
|
Return to query results.
Submit another query.