DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11835 and BTF3L4

DIOPT Version :9

Sequence 1:NP_001259835.1 Gene:CG11835 / 33232 FlyBaseID:FBgn0031264 Length:795 Species:Drosophila melanogaster
Sequence 2:NP_689478.1 Gene:BTF3L4 / 91408 HGNCID:30547 Length:158 Species:Homo sapiens


Alignment Length:162 Identity:103/162 - (63%)
Similarity:120/162 - (74%) Gaps:10/162 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNVEKLKRLQAQVRIGGKGTPRRKKKVMHQTAATDDKKLQSSLKKLSVSTIPGIEEVNIIKDDLT 65
            ||.|||.:||||||||||||.||||||:|:||..||||||||||||:|:.|.||||||:||||.|
Human     1 MNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLKKLAVNNIAGIEEVNMIKDDGT 65

  Fly    66 VIHFNNPKAQASLSANTFAVTGHGETRKVVEMLPDILPQLGQETVVQLRMYA-----NAMNSQKG 125
            ||||||||.||||||||||:|||.|.:.:.||||.||.|||.:::..||..|     ..::|:..
Human    66 VIHFNNPKVQASLSANTFAITGHAEAKPITEMLPGILSQLGADSLTSLRKLAEQFPRQVLDSKAP 130

  Fly   126 APGSGDGPLPAEEDDDVPLLVGDFDEVAKVEA 157
            .|...|     |||||||.||.:|||.:|.||
Human   131 KPEDID-----EEDDDVPDLVENFDEASKNEA 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11835NP_001259835.1 NAC 38..91 CDD:280093 43/52 (83%)
BTF3L4NP_689478.1 NAC_BTF3 4..120 CDD:409234 83/115 (72%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 122..158 18/41 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159256
Domainoid 1 1.000 95 1.000 Domainoid score I7416
eggNOG 1 0.900 - - E1_KOG2240
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435264at2759
OrthoFinder 1 1.000 - - FOG0000935
OrthoInspector 1 1.000 - - mtm8606
orthoMCL 1 0.900 - - OOG6_101091
Panther 1 1.100 - - O PTHR10351
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R790
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.740

Return to query results.
Submit another query.