DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11835 and EGD1

DIOPT Version :9

Sequence 1:NP_001259835.1 Gene:CG11835 / 33232 FlyBaseID:FBgn0031264 Length:795 Species:Drosophila melanogaster
Sequence 2:NP_015288.1 Gene:EGD1 / 856070 SGDID:S000005958 Length:157 Species:Saccharomyces cerevisiae


Alignment Length:143 Identity:48/143 - (33%)
Similarity:68/143 - (47%) Gaps:6/143 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KLKRLQAQVRIGGKGTPRRKKKVMHQTAATDDKKLQSSLKKLSVSTIPGIEEVNIIKDDLTVIHF 69
            ||::|.|..::||......||......|..||.||||.|.||...||..:.|.|..|||..|:||
Yeast    10 KLQKLSANNKVGGTRRKLNKKAGSSAGANKDDTKLQSQLAKLHAVTIDNVAEANFFKDDGKVMHF 74

  Fly    70 NNPKAQASLSANTFAVTGHGETRKVVEMLPDILPQLGQETVVQLRMYANAMNSQKG-APGSGDGP 133
            |....|.:...||....|..:.:.:.::.|.|:.|||.|.:..|...|..|...:. ||...:  
Yeast    75 NKVGVQVAAQHNTSVFYGLPQEKNLQDLFPGIISQLGPEAIQALSQLAAQMEKHEAKAPADAE-- 137

  Fly   134 LPAEEDDDVPLLV 146
               ::|:.:|.||
Yeast   138 ---KKDEAIPELV 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11835NP_001259835.1 NAC 38..91 CDD:280093 22/52 (42%)
EGD1NP_015288.1 NAC_BTF3 9..125 CDD:409234 41/114 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I3059
eggNOG 1 0.900 - - E1_KOG2240
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000935
OrthoInspector 1 1.000 - - mtm9232
orthoMCL 1 0.900 - - OOG6_101091
Panther 1 1.100 - - O PTHR10351
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R790
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.800

Return to query results.
Submit another query.