DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11835 and BTT1

DIOPT Version :9

Sequence 1:NP_001259835.1 Gene:CG11835 / 33232 FlyBaseID:FBgn0031264 Length:795 Species:Drosophila melanogaster
Sequence 2:NP_010538.1 Gene:BTT1 / 851839 SGDID:S000002660 Length:149 Species:Saccharomyces cerevisiae


Alignment Length:128 Identity:38/128 - (29%)
Similarity:57/128 - (44%) Gaps:1/128 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KLKRLQAQVRIGGKGTPRRKKKVMHQTAATDDKKLQSSLKKLSVSTIPGIEEVNIIKDDLTVIHF 69
            ||.:|.|..::||......||..::.....|:.|||:.|.||...||..:.|.|..|.:..|:||
Yeast    10 KLHKLSAANKVGGTRRKINKKGNLYNNNDKDNTKLQAELHKLHPMTIENVAEANFFKKNGKVLHF 74

  Fly    70 NNPKAQASLSANTFAVTGHGETRKVVEMLPDILPQLGQETVVQLRMYA-NAMNSQKGAPGSGD 131
            |:...|.:...|...:.|..:...:..:.|.:..|||.:.:..|...| |..|.|......||
Yeast    75 NSAVVQIAPQCNLTMIHGQPKENTLNGLYPSVASQLGSQELEYLTGLAHNLENEQTVLDQLGD 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11835NP_001259835.1 NAC 38..91 CDD:280093 18/52 (35%)
BTT1NP_010538.1 NAC_BTF3 9..125 CDD:409234 33/114 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I3059
eggNOG 1 0.900 - - E1_KOG2240
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000935
OrthoInspector 1 1.000 - - mtm9232
orthoMCL 1 0.900 - - OOG6_101091
Panther 1 1.100 - - O PTHR10351
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.770

Return to query results.
Submit another query.