DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11835 and NUP60

DIOPT Version :9

Sequence 1:NP_001259835.1 Gene:CG11835 / 33232 FlyBaseID:FBgn0031264 Length:795 Species:Drosophila melanogaster
Sequence 2:NP_009401.1 Gene:NUP60 / 851263 SGDID:S000000063 Length:539 Species:Saccharomyces cerevisiae


Alignment Length:450 Identity:101/450 - (22%)
Similarity:162/450 - (36%) Gaps:119/450 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 KESAEIKAKDK-QQQQPKKE--QKQSAKVPETTNPSENPKEKQENKK------GQAKNN--KKGD 219
            |:||.:..::. ..:||:.|  .::.:.:|.....||...:...|:.      |:|:|:  .|.:
Yeast    43 KDSARVSPRNNVANKQPRNESFNRRISSMPGGYFHSEISPDSTVNRSVVVSAVGEARNDIENKEE 107

  Fly   220 PQTNKDKTNKSKDQAKGQPAPQANKETT----QAAQALKQNPSKPAVQQKKDQVLA----VDQK- 275
            ......:||.|..:.....:.:.|:..:    :...:|.|..||..:..:.:|..|    :||. 
Yeast   108 EYDETHETNISNAKLANFFSKKGNEPLSEIEIEGVMSLLQKSSKSMITSEGEQKSAEGNNIDQSL 172

  Fly   276 -IEANG----AIQKAQ--QPK---------------------------PAETKSTDQKVEPKSAE 306
             ::.:|    :|..|.  .||                           |:..|:|   |...||.
Yeast   173 ILKESGSTPISISNAPTFNPKYDTSNASMNTTLGSIGSRKYSFNYSSLPSPYKTT---VYRYSAA 234

  Fly   307 KQV-------DKAKPIEQTKTKESKVEHPKPAQK----------QLDQNTQAKPTAERSEAKP-- 352
            |::       ..|:.|...|:..|.|....|::|          .||:|...|..|....|.|  
Yeast   235 KKIPDTYTANTSAQSIASAKSVRSGVSKSAPSKKISNTAAALVSLLDENDSKKNNAASELANPYS 299

  Fly   353 -----------VVPTPEPQK---SAPPAVQTLAQIVALPAEKP---ANEAVAAPKAEEQKKDSSG 400
                       |.|...|::   .....|:.|.|.|....|:|   .|....:|.|  ..|||. 
Yeast   300 SYVSQIRKHKRVSPNAAPRQEISEEETTVKPLFQNVPEQGEEPMKQLNATKISPSA--PSKDSF- 361

  Fly   401 PAKVEPAITPSAPQPVTTAE-PPKSALKQDSPPKSA-------PKQGSPPKNVPKQESPPQSAPK 457
             .|.:||.:.|....|..|| .|:.....|.||.||       .:...|.:|..|.|:.|.::.|
Yeast   362 -TKYKPARSSSLRSNVVVAETSPEKKDGGDKPPSSAFNFSFNTSRNVEPTENAYKSENAPSASSK 425

  Fly   458 -------QDSPPKGAPKQ-----DSPPKGAPKQDSPPKGAPK--QDSAPQQKTPPPVKQE 503
                   |..|..|.||.     ||.|.......:|.|.:.|  ..::.|:|:...:.||
Yeast   426 EFNFTNLQAKPLVGKPKTELTKGDSTPVQPDLSVTPQKSSSKGFVFNSVQKKSRSNLSQE 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11835NP_001259835.1 NAC 38..91 CDD:280093
NUP60NP_009401.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.759104 Normalized mean entropy S2165
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.