DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11835 and AT1G73230

DIOPT Version :9

Sequence 1:NP_001259835.1 Gene:CG11835 / 33232 FlyBaseID:FBgn0031264 Length:795 Species:Drosophila melanogaster
Sequence 2:NP_177466.1 Gene:AT1G73230 / 843657 AraportID:AT1G73230 Length:165 Species:Arabidopsis thaliana


Alignment Length:164 Identity:86/164 - (52%)
Similarity:115/164 - (70%) Gaps:8/164 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNVEKLKRLQAQVRIGGKGTPRRKKKVMHQTAATDDKKLQSSLKKLSVSTIPGIEEVNIIKDDLT 65
            ||.|||.::...||.|||||.|||||.:|:|..||||:|||:||::.|::||.||||||.|||: 
plant     1 MNREKLMKMANTVRTGGKGTVRRKKKAVHKTTTTDDKRLQSTLKRVGVNSIPAIEEVNIFKDDV- 64

  Fly    66 VIHFNNPKAQASLSANTFAVTGHGETRKVVEMLPDILPQLGQETVVQLRMYANAMNSQKGAPGSG 130
            ||.|.|||.|||::|||:.|:|..:|:|:.::||.|:.|||.:.:..|:..|...  ||.|||:|
plant    65 VIQFINPKVQASIAANTWVVSGTPQTKKLQDILPQIISQLGPDNLDNLKKLAEQF--QKQAPGAG 127

  Fly   131 DGPLPAEE---DDDVP-LLVGD-FDEVAKVEATK 159
            |.|...:|   ||||| |:||: |:..|..||.|
plant   128 DVPATIQEEDDDDDVPDLVVGETFETPATEEAPK 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11835NP_001259835.1 NAC 38..91 CDD:280093 31/52 (60%)
AT1G73230NP_177466.1 NAC_BTF3 4..119 CDD:409234 62/115 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 69 1.000 Domainoid score I3432
eggNOG 1 0.900 - - E1_KOG2240
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H37453
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435264at2759
OrthoFinder 1 1.000 - - FOG0000935
OrthoInspector 1 1.000 - - mtm973
orthoMCL 1 0.900 - - OOG6_101091
Panther 1 1.100 - - O PTHR10351
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.780

Return to query results.
Submit another query.