DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11835 and Btf3l4

DIOPT Version :9

Sequence 1:NP_001259835.1 Gene:CG11835 / 33232 FlyBaseID:FBgn0031264 Length:795 Species:Drosophila melanogaster
Sequence 2:XP_011238912.1 Gene:Btf3l4 / 70533 MGIID:1915312 Length:188 Species:Mus musculus


Alignment Length:162 Identity:103/162 - (63%)
Similarity:120/162 - (74%) Gaps:10/162 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNVEKLKRLQAQVRIGGKGTPRRKKKVMHQTAATDDKKLQSSLKKLSVSTIPGIEEVNIIKDDLT 65
            ||.|||.:||||||||||||.||||||:|:||..||||||||||||:|:.|.||||||:||||.|
Mouse    31 MNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLKKLAVNNIAGIEEVNMIKDDGT 95

  Fly    66 VIHFNNPKAQASLSANTFAVTGHGETRKVVEMLPDILPQLGQETVVQLRMYA-----NAMNSQKG 125
            ||||||||.||||||||||:|||.|.:.:.||||.||.|||.:::..||..|     ..::|:..
Mouse    96 VIHFNNPKVQASLSANTFAITGHAEAKPITEMLPGILSQLGADSLTSLRKLAEQFPRQVLDSKAP 160

  Fly   126 APGSGDGPLPAEEDDDVPLLVGDFDEVAKVEA 157
            .|...|     |||||||.||.:|||.:|.||
Mouse   161 KPEDID-----EEDDDVPDLVENFDEASKNEA 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11835NP_001259835.1 NAC 38..91 CDD:280093 43/52 (83%)
Btf3l4XP_011238912.1 NAC 68..120 CDD:376630 43/51 (84%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849625
Domainoid 1 1.000 95 1.000 Domainoid score I7401
eggNOG 1 0.900 - - E1_KOG2240
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000935
OrthoInspector 1 1.000 - - mtm8840
orthoMCL 1 0.900 - - OOG6_101091
Panther 1 1.100 - - O PTHR10351
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R790
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.730

Return to query results.
Submit another query.