DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11835 and BTF3

DIOPT Version :9

Sequence 1:NP_001259835.1 Gene:CG11835 / 33232 FlyBaseID:FBgn0031264 Length:795 Species:Drosophila melanogaster
Sequence 2:NP_001032726.1 Gene:BTF3 / 689 HGNCID:1125 Length:206 Species:Homo sapiens


Alignment Length:161 Identity:97/161 - (60%)
Similarity:117/161 - (72%) Gaps:9/161 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNVEKLKRLQAQVRIGGKGTPRRKKKVMHQTAATDDKKLQSSLKKLSVSTIPGIEEVNIIKDDLT 65
            ||.|||.:||||||||||||.||||||:|:||..||||||.|||||.|:.|.||||||:..:..|
Human    50 MNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQFSLKKLGVNNISGIEEVNMFTNQGT 114

  Fly    66 VIHFNNPKAQASLSANTFAVTGHGETRKVVEMLPDILPQLGQETVVQLRMYANAMNSQKGAPGSG 130
            ||||||||.||||:||||.:|||.||:::.||||.||.|||.:::..||..|.|:..|     |.
Human   115 VIHFNNPKVQASLAANTFTITGHAETKQLTEMLPSILNQLGADSLTSLRRLAEALPKQ-----SV 174

  Fly   131 DGPLP----AEEDDDVPLLVGDFDEVAKVEA 157
            ||..|    .::||:||.||.:|||.:|.||
Human   175 DGKAPLATGEDDDDEVPDLVENFDEASKNEA 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11835NP_001259835.1 NAC 38..91 CDD:280093 36/52 (69%)
BTF3NP_001032726.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..42
NAC 87..140 CDD:376630 36/52 (69%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 170..206 17/41 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2240
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H37453
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435264at2759
OrthoFinder 1 1.000 - - FOG0000935
OrthoInspector 1 1.000 - - mtm8606
orthoMCL 1 0.900 - - OOG6_101091
Panther 1 1.100 - - O PTHR10351
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R790
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.810

Return to query results.
Submit another query.