DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11835 and btf3l4

DIOPT Version :9

Sequence 1:NP_001259835.1 Gene:CG11835 / 33232 FlyBaseID:FBgn0031264 Length:795 Species:Drosophila melanogaster
Sequence 2:NP_001011243.1 Gene:btf3l4 / 496686 XenbaseID:XB-GENE-948236 Length:158 Species:Xenopus tropicalis


Alignment Length:162 Identity:103/162 - (63%)
Similarity:122/162 - (75%) Gaps:10/162 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNVEKLKRLQAQVRIGGKGTPRRKKKVMHQTAATDDKKLQSSLKKLSVSTIPGIEEVNIIKDDLT 65
            ||.|||.:||||||||||||.||||||:|:||..||||||||||||:|:.|.||||||:||||.|
 Frog     1 MNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLKKLAVNNIAGIEEVNMIKDDGT 65

  Fly    66 VIHFNNPKAQASLSANTFAVTGHGETRKVVEMLPDILPQLGQETVVQLRMYA-----NAMNSQKG 125
            ||||||||.||||||||||:|||.|.:::.||||.||.|||.:::..||..|     ..::|:..
 Frog    66 VIHFNNPKVQASLSANTFAITGHAEVKQITEMLPGILSQLGADSLTSLRKLAEQFPRQVLDSKAS 130

  Fly   126 APGSGDGPLPAEEDDDVPLLVGDFDEVAKVEA 157
            .|...:     |||||||.|||:|||.:|.||
 Frog   131 KPEDIE-----EEDDDVPELVGNFDEASKNEA 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11835NP_001259835.1 NAC 38..91 CDD:280093 43/52 (83%)
btf3l4NP_001011243.1 NAC 38..91 CDD:376630 43/52 (83%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 123..158 18/40 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 96 1.000 Domainoid score I7198
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435264at2759
OrthoFinder 1 1.000 - - FOG0000935
OrthoInspector 1 1.000 - - otm49143
Panther 1 1.100 - - O PTHR10351
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R790
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.050

Return to query results.
Submit another query.