DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11835 and bic

DIOPT Version :9

Sequence 1:NP_001259835.1 Gene:CG11835 / 33232 FlyBaseID:FBgn0031264 Length:795 Species:Drosophila melanogaster
Sequence 2:NP_476853.1 Gene:bic / 45827 FlyBaseID:FBgn0000181 Length:169 Species:Drosophila melanogaster


Alignment Length:173 Identity:109/173 - (63%)
Similarity:131/173 - (75%) Gaps:6/173 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNVEKLKRLQAQVRIGGKGTPRRKKKVMHQTAATDDKKLQSSLKKLSVSTIPGIEEVNIIKDDLT 65
            ||.||||:||||||||||||||||||::|.|.||||||||||||||||:||||||||||||:|.|
  Fly     1 MNAEKLKKLQAQVRIGGKGTPRRKKKIVHSTPATDDKKLQSSLKKLSVNTIPGIEEVNIIKNDGT 65

  Fly    66 VIHFNNPKAQASLSANTFAVTGHGETRKVVEMLPDILPQLGQETVVQLRMYANAMNSQKGAPGSG 130
            |||||||||||||..||||:|||||.:.:.||:|.||.|||.:.:.||:..|..:.|:.||.|:.
  Fly    66 VIHFNNPKAQASLPTNTFAITGHGENKTITEMVPGILTQLGPQDINQLKKLATEIASKSGAGGAA 130

  Fly   131 DGPLPAEEDDDVPLLVGDFDEVAKVEATKQPVHEPKESAEIKA 173
            ........|||||.||.:|:||| :..||:     ::|.|:.|
  Fly   131 GSSAADAGDDDVPDLVENFEEVA-IADTKE-----EKSGEVAA 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11835NP_001259835.1 NAC 38..91 CDD:280093 46/52 (88%)
bicNP_476853.1 NAC 38..90 CDD:280093 45/51 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469331
Domainoid 1 1.000 69 1.000 Domainoid score I3432
eggNOG 1 0.900 - - E1_KOG2240
Homologene 1 1.000 - - H37453
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435264at2759
OrthoFinder 1 1.000 - - FOG0000935
OrthoInspector 1 1.000 - - mtm8840
orthoMCL 1 0.900 - - OOG6_101091
Panther 1 1.100 - - P PTHR10351
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R790
SonicParanoid 00.000 Not matched by this tool.
1110.780

Return to query results.
Submit another query.