DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11835 and Btf3l4

DIOPT Version :9

Sequence 1:NP_001259835.1 Gene:CG11835 / 33232 FlyBaseID:FBgn0031264 Length:795 Species:Drosophila melanogaster
Sequence 2:XP_006238641.1 Gene:Btf3l4 / 366434 RGDID:1311774 Length:158 Species:Rattus norvegicus


Alignment Length:162 Identity:103/162 - (63%)
Similarity:120/162 - (74%) Gaps:10/162 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNVEKLKRLQAQVRIGGKGTPRRKKKVMHQTAATDDKKLQSSLKKLSVSTIPGIEEVNIIKDDLT 65
            ||.|||.:||||||||||||.||||||:|:||..||||||||||||:|:.|.||||||:||||.|
  Rat     1 MNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLKKLAVNNIAGIEEVNMIKDDGT 65

  Fly    66 VIHFNNPKAQASLSANTFAVTGHGETRKVVEMLPDILPQLGQETVVQLRMYA-----NAMNSQKG 125
            ||||||||.||||||||||:|||.|.:.:.||||.||.|||.:::..||..|     ..::|:..
  Rat    66 VIHFNNPKVQASLSANTFAITGHAEAKPITEMLPGILSQLGADSLTSLRKLAEQFPRQVLDSKAP 130

  Fly   126 APGSGDGPLPAEEDDDVPLLVGDFDEVAKVEA 157
            .|...|     |||||||.||.:|||.:|.||
  Rat   131 KPEDID-----EEDDDVPDLVENFDEASKNEA 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11835NP_001259835.1 NAC 38..91 CDD:280093 43/52 (83%)
Btf3l4XP_006238641.1 NAC_BTF3 4..120 CDD:409234 83/115 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353277
Domainoid 1 1.000 95 1.000 Domainoid score I7208
eggNOG 1 0.900 - - E1_KOG2240
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435264at2759
OrthoFinder 1 1.000 - - FOG0000935
OrthoInspector 1 1.000 - - otm46058
orthoMCL 1 0.900 - - OOG6_101091
Panther 1 1.100 - - O PTHR10351
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.710

Return to query results.
Submit another query.