DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11835 and betaNACtes4

DIOPT Version :9

Sequence 1:NP_001259835.1 Gene:CG11835 / 33232 FlyBaseID:FBgn0031264 Length:795 Species:Drosophila melanogaster
Sequence 2:NP_572960.1 Gene:betaNACtes4 / 32389 FlyBaseID:FBgn0030566 Length:263 Species:Drosophila melanogaster


Alignment Length:288 Identity:70/288 - (24%)
Similarity:113/288 - (39%) Gaps:72/288 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNVEKLKRLQAQVRIGGKGTPRRKKKVMHQTAATDDKKLQSSLKKLSVSTIPGIEEVNIIKDDLT 65
            |:..|.:.::..|||||||:.|||.|.:...||.|:|::|::|.|:.:..|.||.|:.|...|.:
  Fly     1 MDFNKRQNMEEVVRIGGKGSMRRKHKRIPSVAAVDEKRVQATLAKIPLKNISGIHELTIEFTDSS 65

  Fly    66 VIHFNNPKAQASLSANTFAVTGHGETRKVVEMLPDILPQLGQETVVQLRMYANAMNSQKG--APG 128
            .:....||.| .:|||...|......||.....|.           ::...|.|..:.|.  ||.
  Fly    66 EVVVVMPKVQ-GISANGLLVVNGDFVRKSSTAGPS-----------KMAKAAKAPKAPKAPKAPK 118

  Fly   129 SGDGPLPAEEDDDVPLLVGDFDEVAKVEATKQPVHEPKESAEIKAKDKQQQQPKKEQ--KQSAKV 191
            :...|:       .|:            |...|:....|:..:|       :|:.|:  |..||.
  Fly   119 TPMAPM-------APM------------APMAPMTPKPEAFSVK-------KPESEETIKVVAKK 157

  Fly   192 PETTNPSENPKEKQENKKGQ---AKNNKK-----GD--PQTNKDKTNKSKDQAKGQPAPQANKET 246
            |:.......|:    |||.|   :|||::     ||  |:.:..|:.....:....|        
  Fly   158 PKKLRNRVRPR----NKKVQMMLSKNNEEAAMAGGDSEPKLSNGKSILISSEDGSDP-------- 210

  Fly   247 TQAAQALKQNPSKPAVQQKKDQVLAVDQ 274
                    .|...|:.:...|:.:..|:
  Fly   211 --------DNEKVPSDESDVDRTVVCDK 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11835NP_001259835.1 NAC 38..91 CDD:280093 16/52 (31%)
betaNACtes4NP_572960.1 NAC 38..91 CDD:280093 16/53 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2240
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435264at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10351
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.