DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11835 and betaNACtes6

DIOPT Version :9

Sequence 1:NP_001259835.1 Gene:CG11835 / 33232 FlyBaseID:FBgn0031264 Length:795 Species:Drosophila melanogaster
Sequence 2:NP_727778.1 Gene:betaNACtes6 / 318107 FlyBaseID:FBgn0052598 Length:262 Species:Drosophila melanogaster


Alignment Length:295 Identity:69/295 - (23%)
Similarity:118/295 - (40%) Gaps:61/295 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNVEKLKRLQAQVRIGGKGTPRRKKKVMHQTAATDDKKLQSSLKKLSVSTIPGIEEVNIIKDDLT 65
            |:.:|||:::..|||||||:.|||.| .:.:.|..:|::|:.|..|.:..|..|:||.|...:..
  Fly     1 MDFKKLKKMEEAVRIGGKGSMRRKHK-RNPSPAVVEKRVQAELAMLPLRNIGEIQEVTIEFTNSR 64

  Fly    66 VIHFNNPKAQASLSANTFAVTGHGETRKVVEMLPDILPQ---LGQETVVQLRMYANAMNSQKGAP 127
            .:....||.|.:...:.|.|:|            |::.:   .|...|      |.|.|:.| ||
  Fly    65 EVVLTMPKVQGTPPNSFFVVSG------------DLVRKSSTAGPSKV------AKAANAPK-AP 110

  Fly   128 GSGDGPLPAEEDDDVPLLVGDFDEVAKVEATKQPVHEPKESAEIKAKDKQQQQPKKEQKQSAKVP 192
            .....|.|....|..|      :....::..|:| .:|:.....:.| |.|....|.::::|...
  Fly   111 MPPKPPKPEAFSDKKP------ESGESIKVAKKP-KKPRNRVRPRNK-KVQMMLSKNKEEAAMAG 167

  Fly   193 ETTNPSENPKEKQENKKGQAKNNKKG-DPQTNKDKTNKS---------KDQAKGQPAPQANKETT 247
            ..:.|      |..|.|....:::.| ||...|..:::|         ||..:........||..
  Fly   168 GDSEP------KLSNGKSILISSEDGSDPNNGKVPSDESDVDRTVVCAKDSLRSFGDYSDGKEDD 226

  Fly   248 QAAQAL--------------KQNPSKPAVQQKKDQ 268
            .:.:::              :.||.....|..:|:
  Fly   227 DSKESIYLSSYSDYYDSADEQLNPKTYRAQVSEDE 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11835NP_001259835.1 NAC 38..91 CDD:280093 14/52 (27%)
betaNACtes6NP_727778.1 NAC 37..87 CDD:280093 14/61 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2240
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435264at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10351
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.