DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11835 and RAB11FIP2

DIOPT Version :9

Sequence 1:NP_001259835.1 Gene:CG11835 / 33232 FlyBaseID:FBgn0031264 Length:795 Species:Drosophila melanogaster
Sequence 2:NP_001317096.1 Gene:RAB11FIP2 / 22841 HGNCID:29152 Length:532 Species:Homo sapiens


Alignment Length:164 Identity:37/164 - (22%)
Similarity:57/164 - (34%) Gaps:61/164 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 EATKQPVHEPKESAEIKAKDKQQQQPKKE--------------QKQSAKVPETTNPSENPKEKQ- 205
            |.|.:||.:.:.|.|:... ..|..|:|.              .|...:|....|.....|::: 
Human    53 EKTLEPVWKEEASFELPGL-LIQGSPEKYILFLIVMHRSLVGLDKFLGQVAINLNDIFEDKQRRK 116

  Fly   206 ------ENKKGQAKNNKKGDPQTN-----------------KDKTN----KSKDQAKGQ------ 237
                  |:|:|:...| :|:.:.|                 ||||.    |.||:.||:      
Human   117 TEWFRLESKQGKRIKN-RGEIKVNIQFMRNNMTASMFDLSMKDKTRSPFAKLKDKMKGRKNDGTF 180

  Fly   238 --------PA---PQANKETTQAAQALKQNPSKP 260
                    |:   |.||.|.:.....:|..|.||
Human   181 SDTSSAIIPSTHMPDANSEFSSGEIQMKSKPKKP 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11835NP_001259835.1 NAC 38..91 CDD:280093
RAB11FIP2NP_001317096.1 C2_Rab11-FIP_classI 15..141 CDD:176064 19/89 (21%)
RBD-FIP 472..519 CDD:255374
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.