DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11835 and icd-1

DIOPT Version :9

Sequence 1:NP_001259835.1 Gene:CG11835 / 33232 FlyBaseID:FBgn0031264 Length:795 Species:Drosophila melanogaster
Sequence 2:NP_495336.1 Gene:icd-1 / 174090 WormBaseID:WBGene00002045 Length:161 Species:Caenorhabditis elegans


Alignment Length:156 Identity:97/156 - (62%)
Similarity:119/156 - (76%) Gaps:11/156 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 EKLKRLQAQ---VRIGGKGTPRRKKKVMHQTAATDDKKLQSSLKKLSVSTIPGIEEVNIIKDDLT 65
            |::|:||||   |||||||||||||||:|:|||.|||||||:||||||:.||||||||:||||.|
 Worm     8 ERIKKLQAQQEHVRIGGKGTPRRKKKVIHKTAAADDKKLQSNLKKLSVTNIPGIEEVNMIKDDGT 72

  Fly    66 VIHFNNPKAQASLSANTFAVTGHGETRKVVEMLPDILPQLGQETVVQLRMYANAMNSQKGAPGSG 130
            ||||||||.|.|:.||||:|||..:.:::.||||.||.|||.|::..|:..||.: ::.|..|.|
 Worm    73 VIHFNNPKVQTSVPANTFSVTGSADNKQITEMLPGILNQLGPESLTHLKKLANNV-TKLGPDGKG 136

  Fly   131 DGPLPAEEDDDVPLLVGDFDEVAKVE 156
                   ||:|||.||||||..:|.|
 Worm   137 -------EDEDVPELVGDFDAASKNE 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11835NP_001259835.1 NAC 38..91 CDD:280093 40/52 (77%)
icd-1NP_495336.1 NAC 45..96 CDD:280093 40/50 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 92 1.000 Domainoid score I4804
eggNOG 1 0.900 - - E1_KOG2240
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435264at2759
OrthoFinder 1 1.000 - - FOG0000935
OrthoInspector 1 1.000 - - otm14572
orthoMCL 1 0.900 - - OOG6_101091
Panther 1 1.100 - - O PTHR10351
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R790
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.850

Return to query results.
Submit another query.