DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tspo and TSPO

DIOPT Version :9

Sequence 1:NP_608531.1 Gene:Tspo / 33231 FlyBaseID:FBgn0031263 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_566110.1 Gene:TSPO / 819389 AraportID:AT2G47770 Length:196 Species:Arabidopsis thaliana


Alignment Length:169 Identity:45/169 - (26%)
Similarity:63/169 - (37%) Gaps:32/169 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADRPCAGNILRIAGAVILPNLG----GIYNGRLTRQHLQSWYANLKFPSFKPPNSVFAPMWI-- 59
            ||.|......:.:|..|::....    |..:|...|....||               ..|:|:  
plant    42 MAKRGLKSLTVAVAAPVLVTLFATYFLGTSDGYGNRAKSSSW---------------IPPLWLLH 91

  Fly    60 -SLYAG---MGYGSYLVWRDGGGFAGEAAKLP--LIAYGTQLALNWAWTPIFFGQHNIKGGLIDI 118
             :..|.   ||..::|||.|||     ..|.|  |..|..|..|...|.|:.|...:...||...
plant    92 TTCLASSGLMGLAAWLVWVDGG-----FHKKPNALYLYLAQFLLCLVWDPVTFRVGSGVAGLAVW 151

  Fly   119 VALTAAASACGVLFYRVNKTAGLLFVPYVAWLGFATALN 157
            :..:||...|...|..::..||.|..|.:||..|..|:|
plant   152 LGQSAALFGCYKAFNEISPVAGNLVKPCLAWAAFVAAVN 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TspoNP_608531.1 TspO_MBR 17..161 CDD:281118 41/153 (27%)
TSPONP_566110.1 TSPO_MBR 50..190 CDD:320706 41/159 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 48 1.000 Domainoid score I4506
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 48 1.000 Inparanoid score I2655
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1592225at2759
OrthoFinder 1 1.000 - - FOG0003750
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10057
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.070

Return to query results.
Submit another query.