DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tspo and TSPO

DIOPT Version :9

Sequence 1:NP_608531.1 Gene:Tspo / 33231 FlyBaseID:FBgn0031263 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_000705.2 Gene:TSPO / 706 HGNCID:1158 Length:169 Species:Homo sapiens


Alignment Length:150 Identity:70/150 - (46%)
Similarity:94/150 - (62%) Gaps:1/150 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GAVILPNLGGIYNGRLTRQHLQSWYANLKFPSFKPPNSVFAPMWISLYAGMGYGSYLVWRDGGGF 79
            |..:.|:||.....|........|||.|:.||:.||:.|..|:|.:||:.|||||||||::.|||
Human    10 GFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAMGYGSYLVWKELGGF 74

  Fly    80 AGEAAKLPLIAYGTQLALNWAWTPIFFGQHNIKGGLIDIVALTAAASACGVLFYRVNKTAGLLFV 144
            . |.|.:||..|..||||||||.|||||...:...|:|::.::.||:|..|.:|:|:..|..|..
Human    75 T-EKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAAATTVAWYQVSPLAARLLY 138

  Fly   145 PYVAWLGFATALNYAIWKLN 164
            ||:|||.|.|.|||.:|:.|
Human   139 PYLAWLAFTTTLNYCVWRDN 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TspoNP_608531.1 TspO_MBR 17..161 CDD:281118 67/143 (47%)
TSPONP_000705.2 TspO_MBR 12..155 CDD:281118 67/143 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159694
Domainoid 1 1.000 144 1.000 Domainoid score I4625
eggNOG 1 0.900 - - E1_COG3476
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H574
Inparanoid 1 1.050 147 1.000 Inparanoid score I4423
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52353
OrthoDB 1 1.010 - - D1592225at2759
OrthoFinder 1 1.000 - - FOG0003750
OrthoInspector 1 1.000 - - oto90937
orthoMCL 1 0.900 - - OOG6_102539
Panther 1 1.100 - - LDO PTHR10057
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1562
SonicParanoid 1 1.000 - - X5530
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.