DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tspo and tspo-1

DIOPT Version :9

Sequence 1:NP_608531.1 Gene:Tspo / 33231 FlyBaseID:FBgn0031263 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_001251116.1 Gene:tspo-1 / 7040157 WormBaseID:WBGene00077771 Length:212 Species:Caenorhabditis elegans


Alignment Length:140 Identity:52/140 - (37%)
Similarity:77/140 - (55%) Gaps:16/140 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 QHLQSWYANLKFPSFKPPN-SVFAPMWISLYAGMGYGSYLVWRDGGGFAGEAAKLPLIAYGTQLA 96
            |.:..|:|.||.|::.|.: .|::.:.:...:.:||.||||:::||||.....||.|..||..:.
 Worm    75 QQVADWWAALKKPNWAPKDVRVYSAVDLLTLSPLGYASYLVYKNGGGFDYNDTKLALGLYGASVT 139

  Fly    97 LNWAWTPIFFGQHNIK----GGL---IDIVALTAAASACGVLFYRVNKTAGLLFVPYVAWLGFAT 154
            |..|..||      :|    |.|   ..:|:|||||::  ..||:::|.||||.||:..|..|..
 Worm   140 LAVATIPI------VKKKELGCLWKNTTVVSLTAAAAS--FAFYKIDKKAGLLVVPFAVWTAFYA 196

  Fly   155 ALNYAIWKLN 164
            .|.|:|.|.|
 Worm   197 YLAYSIKKEN 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TspoNP_608531.1 TspO_MBR 17..161 CDD:281118 49/135 (36%)
tspo-1NP_001251116.1 TspO_MBR 79..202 CDD:281118 48/130 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167238
Domainoid 1 1.000 76 1.000 Domainoid score I5855
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 78 1.000 Inparanoid score I3821
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1592225at2759
OrthoFinder 1 1.000 - - FOG0003750
OrthoInspector 1 1.000 - - oto20068
orthoMCL 1 0.900 - - OOG6_102539
Panther 1 1.100 - - LDO PTHR10057
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1562
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.930

Return to query results.
Submit another query.