DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tspo and Tspo2

DIOPT Version :9

Sequence 1:NP_608531.1 Gene:Tspo / 33231 FlyBaseID:FBgn0031263 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_081568.1 Gene:Tspo2 / 70026 MGIID:1917276 Length:162 Species:Mus musculus


Alignment Length:155 Identity:55/155 - (35%)
Similarity:85/155 - (54%) Gaps:5/155 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LRIAGAVI--LPNLGGIYNGRLTRQHLQSWYANLKFPSFKPPNSVFAPMWISLYAGMGYGSYLVW 73
            :::.|.|.  :|.||.|....|..|.........|.| :.||:.|...:|:::|:.|||.|||||
Mouse     1 MQLQGPVFVGVPLLGPILICMLIHQPSSRCEDERKLP-WCPPHKVILLVWVTIYSVMGYASYLVW 64

  Fly    74 RD-GGGFAGEAAKLPLIAYGTQLALNWAWTPIFFGQHNIKGGLIDIVALTAAASACGVLFYRVNK 137
            :: ||||....| |||..|..||||:|.:..:|....:....|:|::.|....::...::..:||
Mouse    65 KELGGGFRWPLA-LPLGLYSFQLALSWTFLVLFLAADSPGLALLDLLLLYGLVASLVFIWQPINK 128

  Fly   138 TAGLLFVPYVAWLGFATALNYAIWK 162
            .|.||.:||:|||...||:.|.:|:
Mouse   129 LAALLLLPYLAWLTVTTAITYRLWR 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TspoNP_608531.1 TspO_MBR 17..161 CDD:281118 53/146 (36%)
Tspo2NP_081568.1 TspO_MBR 10..153 CDD:376985 52/144 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850067
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52353
OrthoDB 1 1.010 - - D1592225at2759
OrthoFinder 1 1.000 - - FOG0003750
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10057
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.820

Return to query results.
Submit another query.