DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tspo and Tspo

DIOPT Version :9

Sequence 1:NP_608531.1 Gene:Tspo / 33231 FlyBaseID:FBgn0031263 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_036647.1 Gene:Tspo / 24230 RGDID:2228 Length:169 Species:Rattus norvegicus


Alignment Length:150 Identity:68/150 - (45%)
Similarity:96/150 - (64%) Gaps:1/150 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GAVILPNLGGIYNGRLTRQHLQSWYANLKFPSFKPPNSVFAPMWISLYAGMGYGSYLVWRDGGGF 79
            |..::|:|||.......|.....|||:|:.||:.||....||:|.:||:.||||||::|::.|||
  Rat    10 GLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGF 74

  Fly    80 AGEAAKLPLIAYGTQLALNWAWTPIFFGQHNIKGGLIDIVALTAAASACGVLFYRVNKTAGLLFV 144
            . |.|.:||..|..||||||||.|||||...:...|:|::.::..|:|..:.::||:..|..|..
  Rat    75 T-EEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLY 138

  Fly   145 PYVAWLGFATALNYAIWKLN 164
            ||:|||.|||.|||.:|:.|
  Rat   139 PYLAWLAFATMLNYYVWRDN 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TspoNP_608531.1 TspO_MBR 17..161 CDD:281118 65/143 (45%)
TspoNP_036647.1 TspO_MBR 12..155 CDD:397274 65/142 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353763
Domainoid 1 1.000 144 1.000 Domainoid score I4502
eggNOG 1 0.900 - - E1_COG3476
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H574
Inparanoid 1 1.050 148 1.000 Inparanoid score I4310
OMA 1 1.010 - - QHG52353
OrthoDB 1 1.010 - - D1592225at2759
OrthoFinder 1 1.000 - - FOG0003750
OrthoInspector 1 1.000 - - oto98035
orthoMCL 1 0.900 - - OOG6_102539
Panther 1 1.100 - - LDO PTHR10057
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5530
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.