DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tspo and TSPO2

DIOPT Version :9

Sequence 1:NP_608531.1 Gene:Tspo / 33231 FlyBaseID:FBgn0031263 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_001010873.1 Gene:TSPO2 / 222642 HGNCID:21256 Length:170 Species:Homo sapiens


Alignment Length:168 Identity:58/168 - (34%)
Similarity:91/168 - (54%) Gaps:4/168 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LRIAGA--VILPNLGGIYNGRLTRQHLQSWYANLKFPSFKPPNSVFAPMWISLYAGMGYGSYLVW 73
            :|:.||  |:||:||.|.....||.|:..|....:..|:.|...|...:..::|:.:||.|||||
Human     1 MRLQGAIFVLLPHLGPILVWLFTRDHMSGWCEGPRMLSWCPFYKVLLLVQTAIYSVVGYASYLVW 65

  Fly    74 RDGGGFAGEAAKLPLIAYGTQLALNWAWTPIFFGQHNIKGGLIDIVALTAAASACGVLFYRVNKT 138
            :|.||..|....|||..|..||.::|....:||..||....|:.::.|.....:..::::.:||.
Human    66 KDLGGGLGWPLALPLGLYAVQLTISWTVLVLFFTVHNPGLALLHLLLLYGLVVSTALIWHPINKL 130

  Fly   139 AGLLFVPYVAWLGFATALNYAIWK--LNPEKEQAPKDE 174
            |.||.:||:|||...:||.|.:|:  |.|..:..|.::
Human   131 AALLLLPYLAWLTVTSALTYHLWRDSLCPVHQPQPTEK 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TspoNP_608531.1 TspO_MBR 17..161 CDD:281118 51/143 (36%)
TSPO2NP_001010873.1 TspO_MBR 10..154 CDD:376985 50/143 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159695
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52353
OrthoDB 1 1.010 - - D1592225at2759
OrthoFinder 1 1.000 - - FOG0003750
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10057
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.820

Return to query results.
Submit another query.